Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d043948_circ_g.7 |
ID in PlantcircBase | zma_circ_007837 |
Alias | zma_circ_0001332 |
Organism | Zea mays |
Position | chr3: 214458994-214474608 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d043948 |
Parent gene annotation |
Transducin/WD40 repeat-like superfamily protein |
Parent gene strand | - |
Alternative splicing | Zm00001d043948_circ_g.1 Zm00001d043948_circ_g.2 Zm00001d043948_circ_g.3 Zm00001d043948_circ_g.4 Zm00001d043948_circ_g.5 Zm00001d043948_circ_g.6 Zm00001d043948_circ_g.8 Zm00001d043948_circ_g.9 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d043948_T002:3 Zm00001d043948_T006:3 Zm00001d043948_T003:3 Zm00001d043948_T008:4 Zm00001d043948_T007:1 Zm00001d043948_T004:3 Zm00001d043948_T001:4 Zm00001d043948_T005:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.041937853 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
214474577-214474598(-) |
Potential amino acid sequence |
MFTFAFGGSNGSLLAAGSNAQVKFTPDQQSKLISAAVDGLICVFDTDGDIDDDNHLLSVMNAET SVAKVGFFGNKYKKLWCLTHIETLRYLC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |