Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G34555_circ_g.1 |
| ID in PlantcircBase | ath_circ_034663 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16504890-16505243 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G34555 |
| Parent gene annotation |
40S ribosomal protein S25-3 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G34555.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.271660075 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16504986-16504892(-) |
| Potential amino acid sequence |
MVLFDQATYDKLLSEAPKFKLITPSILSDRLRAPKKDKVPPPSSKPAKSGGGKQKKKKWSKGKQ KEKVNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLRAPKKDKVPPPSSKPAKSGGGKQKKKK WSKGKQKEKVNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLRAPKKDKVPPPSSKPAKSGGG KQKKKKWSKGKQKEKVNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |