Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0303200_circ_g.1 |
| ID in PlantcircBase | osa_circ_001479 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 11213559-11214446 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0303200 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0303200-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0303200_circ_g.2 Os01g0303200_circ_g.3 Os01g0303200_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0303200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009222 |
| PMCS | 0.543927174 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11213648-11213647(+) 11214406-11214400(-) |
| Potential amino acid sequence |
MMKYLRRNLALYPYHLADYICRVSRISPFRYYCDILFEAMKNGLWITASENDYNGILVLLVECA GKGSTMRK*(+) MVRSSKLGRYSLQDDTGIMQDSSGGISSFPHSTPLPCTLYEQNKYSIVIVFGCSNPQSILHSFK QDVTIISKW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |