Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0303200_circ_g.1 |
ID in PlantcircBase | osa_circ_001479 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 11213559-11214446 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0303200 |
Parent gene annotation |
Conserved hypothetical protein. (Os01t0303200-01) |
Parent gene strand | + |
Alternative splicing | Os01g0303200_circ_g.2 Os01g0303200_circ_g.3 Os01g0303200_circ_g.4 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0303200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009222 |
PMCS | 0.543927174 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11213648-11213647(+) 11214406-11214400(-) |
Potential amino acid sequence |
MMKYLRRNLALYPYHLADYICRVSRISPFRYYCDILFEAMKNGLWITASENDYNGILVLLVECA GKGSTMRK*(+) MVRSSKLGRYSLQDDTGIMQDSSGGISSFPHSTPLPCTLYEQNKYSIVIVFGCSNPQSILHSFK QDVTIISKW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |