Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G246900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001465 |
| Alias | Chr13:56560973|56561196 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 56560973-56561196 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G246900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/8 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.013G246900.2:1 Gorai.013G246900.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_001132* gar_circ_000132 |
| PMCS | 1.173735082 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
56561071-56561150(-) |
| Potential amino acid sequence |
MKVSIHSVEAISKRIETLRDEELQPQLLELVHGPEKRLELLTRRKVGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |