Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | orai.002G197500_circ_g.1 |
ID in PlantcircBase | gra_circ_000189 |
Alias | Chr02:53493534|53493988 |
Organism | Gossypium raimondii |
Position | chrChr02: 53493534-53493988 JBrowse» |
Reference genome | Graimondii_221 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gorai.002G197500 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | ovule |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Gorai.002G197500.1:3 Gorai.002G197500.3:3 Gorai.002G197500.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.279052967 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
53493947-53493553(+) |
Potential amino acid sequence |
MHLVFQLFLLGLSLDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFLL AFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLGLCANCL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |