Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0147800_circ_g.1 |
| ID in PlantcircBase | osa_circ_013136 |
| Alias | Os02circ04366 |
| Organism | Oryza sativa |
| Position | chr2: 2622696-2622813 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0147800 |
| Parent gene annotation |
Hypothetical conserved gene. (Os02t0147800-01);Similar to Homeo protein (Fragment). (Os02t0147800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0147800-02:1 Os02t0147800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.460153349 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2622731-2622784(-) 2622747-2622728(-) |
| Potential amino acid sequence |
MTRGICTLNILFLSKGGSKHF*(-) MLLSGNDSWDLHLEHIVFIKRRLQTFLMTRQFAAPLTEYNVIVRK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |