Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0147800_circ_g.1 |
ID in PlantcircBase | osa_circ_013136 |
Alias | Os02circ04366 |
Organism | Oryza sativa |
Position | chr2: 2622696-2622813 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0147800 |
Parent gene annotation |
Hypothetical conserved gene. (Os02t0147800-01);Similar to Homeo protein (Fragment). (Os02t0147800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0147800-02:1 Os02t0147800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.460153349 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2622731-2622784(-) 2622747-2622728(-) |
Potential amino acid sequence |
MTRGICTLNILFLSKGGSKHF*(-) MLLSGNDSWDLHLEHIVFIKRRLQTFLMTRQFAAPLTEYNVIVRK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |