Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0128200_circ_g.1 |
| ID in PlantcircBase | osa_circ_029490 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 1488214-1488559 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0128200 |
| Parent gene annotation |
LMBR1-like conserved region domain containing protein. (Os06t012 8200-01);Similar to predicted protein. (Os06t0128200-02);Non-pro tein coding transcript. (Os06t0128200-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0128200_circ_g.2 |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0128200-02:1 Os06t0128200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223302384 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1488484-1488277(+) 1488235-1488465(-) 1488246-1488328(-) |
| Potential amino acid sequence |
MTAFGRRTNENISPNGRQAIPTPPNIFPRALTFLRHFLPFFPLFSSW*(+) MSRPLGRYLVVLELLAFHWDLYSHLSGAQKLSLHAHNI*(-) MAQKCQGPWEDIWWCWNCLPSIGTYILICPAPKSCHYTLTIYKGSN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |