Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0835600_circ_g.3 |
| ID in PlantcircBase | osa_circ_004750 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 35816736-35816882 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0835500 |
| Parent gene annotation |
Similar to Respiratory burst oxidase protein. (Os01t0835500-01); Similar to respiratory burst oxidase protein A. (Os01t0835500-02 );Similar to Respiratory burst oxidase-like protein J. (Os01t083 5500-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0835600-03:1 Os01t0835600-05:1 Os01t0835500-03:1 Os01t0835500-01:1 Os01t0835600-03:1 Os01t0835600-05:1 Os01t0835500-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.395235658 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35816854-35816879(+) 35816755-35816738(-) |
| Potential amino acid sequence |
MNDVAESDHNEVESIHGSEIGSFKNNGPGRAYFYWVTREQGSFEWFKGVMNDVAESDHNEVESI HGSEIGSFKNNGPGRAYFYWVTREQGSFEWFKGVMNDVAESDHNEVESIHGSEIGSFKNNGPGR AYFYWVTREQGSFEWFKGVMNDVAESDHN(+) MYAFHLIVITFSDIVHDSFKPLEGPLLSGHPVEVSSSWPIVLEAAYLRTMYAFHLIVITFSDIV HDSFKPLEGPLLSGHPVEVSSSWPIVLEAAYLRTMYAFHLIVITFSDIVHDSFKPLEGPLLSGH PVEVSSSWPIVLEAAYLRTMYAFHL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |