Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_20G116100_circ_g.1 |
| ID in PlantcircBase | gma_circ_007769 |
| Alias | gma-circRNA2751, circRNA730 |
| Organism | Glycine max |
| Position | chr20: 35815052-35815388 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI, CIRCexplorer |
| Parent gene | GLYMA_20G116100 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud, pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG90822:1 KRG90821:1 KRG90820:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.247465183 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35815359-35815086(+) 35815159-35815314(-) |
| Potential amino acid sequence |
MVLRPRFSPFPPAIPLSLGIRR*(+) MRGQKSRSGPGVRKGFEGGQMPLYRRIPKLRGIAGGNGENLGRKTMAEEDSASKTPHFRG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility (with protein-coding potential) |
| Other Information | |
|---|---|
| References | Chen et al., 2018; Ma et al., 2021a |