Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0533200_circ_g.1 |
| ID in PlantcircBase | osa_circ_014906 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 19632805-19633336 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0533200 |
| Parent gene annotation |
SOUL haem-binding protein domain containing protein. (Os02t05332 00-00) |
| Parent gene strand | + |
| Alternative splicing | Os02g0533200_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0533200-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003978* |
| PMCS | 0.165908177 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19633035-19633256(+) |
| Potential amino acid sequence |
MPGRSGFDFNGSSQSFNVLASYLFGKNTTSEQMEMTTPVFTRKGEPDGEKMDMTTPVITKKCPI SRPSPSASSSARRSTRSEKWSPTMSLRRQCLEEADSISMDHPSHSTCWRLTYLVRTRLLSKWK* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |