Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0533200_circ_g.1 |
ID in PlantcircBase | osa_circ_014906 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 19632805-19633336 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0533200 |
Parent gene annotation |
SOUL haem-binding protein domain containing protein. (Os02t05332 00-00) |
Parent gene strand | + |
Alternative splicing | Os02g0533200_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0533200-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003978* |
PMCS | 0.165908177 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19633035-19633256(+) |
Potential amino acid sequence |
MPGRSGFDFNGSSQSFNVLASYLFGKNTTSEQMEMTTPVFTRKGEPDGEKMDMTTPVITKKCPI SRPSPSASSSARRSTRSEKWSPTMSLRRQCLEEADSISMDHPSHSTCWRLTYLVRTRLLSKWK* (+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |