Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G124100_circ_g.1 |
| ID in PlantcircBase | gra_circ_001219 |
| Alias | Chr11:17533470|17534747 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 17533470-17534747 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G124100 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.011G124100.2:2 Gorai.011G124100.4:1 Gorai.011G124100.5:2 Gorai.011G124100.3:2 Gorai.011G124100.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.764288993 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17534043-17534676(-) |
| Potential amino acid sequence |
MLGHSKSLREHNNRSMLVKANVENLPAAGAETVSEVACMGNEVGRLSSFSGNANAIIEESCQQI PRTSTRVTVGEDDCDSIEESCNEIESASESVPEILDNDLQFFESIGIKMDGRCSSSVIGSAEPN DKRFEVIANRREWKKSNCCSAKVD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |