Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G303800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000996 |
| Alias | Chr09:27368317|27369167 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 27368317-27369167 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G303800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.009G303800.2:4 Gorai.009G303800.1:4 Gorai.009G303800.4:3 Gorai.009G303800.3:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124929426 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27368360-27369163(-) 27368991-27369163(-) |
| Potential amino acid sequence |
MSTTNWTISTRIIGDSKFTQQELPACKPILTPRWVISAFMLVSIVFIPIGVVSLFASRDVVEII DRYETACVPDGYKNDKVTFIQSNLTKQCNRTLTVKKRMKKPIYVYYQLDNFYQNHRRL*(-) MLVSIVFIPIGVVSLFASRDVVEIIDRYETACVPDGYKNDKVTFIQSNLTKQCNRTLTVKKRMK KPIYVYYQLDNFYQNHRRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |