Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0719800_circ_g.4 |
| ID in PlantcircBase | osa_circ_016313 |
| Alias | Os_ciR2892 |
| Organism | Oryza sativa |
| Position | chr2: 29862319-29862785 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0719800 |
| Parent gene annotation |
Similar to AML1. (Os02t0719800-01);Nucleotide-binding, alpha-bet a plait domain containing protein. (Os02t0719800-02);Similar to AML1. (Os02t0719800-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0719800_circ_g.5 Os02g0719800_circ_g.6 |
| Support reads | 4/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0719800-02:1 Os02t0719800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004224* osi_circ_012216 |
| PMCS | 0.405866149 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29862355-29862351(+) |
| Potential amino acid sequence |
MDDASAKLKELDDDPEGKDYKFDFDLRQIDDLLPNEDDLFAGITNEIEPAGQTNSMEELEEFDV FGSGGGMELDTDPVESITAGLGNTSIADGLRGNGVNHFGPSNSASTVAGEHPYGEHPSRTLFVR NINSNVDDTELRSLFESTFLILHVAPH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |