Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g081610.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003198 |
Alias | NA |
Organism | Solanum lycopersicum |
Position | chr10: 62652995-62653141 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc10g081610.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc10g081610.1.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002451 |
PMCS | 0.440484694 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
62653077-62652997(-) |
Potential amino acid sequence |
MLVYIRESDKDKIICDVGEKDIAEHLRLPQTNPGFNNTPFKFTKYSNAYMLVYIRESDKDKIIC DVGEKDIAEHLRLPQTNPGFNNTPFKFTKYSNAYMLVYIRESDKDKIICDVGEKDIAEHLRLPQ TNPGFNNTPFKFTKYSNAYMLVYIRESDKDKIICDVGEKDIAEHLR(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zuo et al., 2016 |