Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc09g065900.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002917 |
| Alias | 9:59795283|59796148 |
| Organism | Solanum lycopersicum |
| Position | chr9: 64197764-64198629 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc09g065900.2 |
| Parent gene annotation |
Glutathione reductase, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc09g065900.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.635623266 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
64198584-64197800(+) 64197918-64198569(-) |
| Potential amino acid sequence |
MHIRAISWVHIPEAHTLVFGLRPVANMI*(+) MSLRGIEFHTEESPQAIVKSADGSLSIKTNRGTVEGFSHIMFATGRSPNTKVCASGMCTQEIAR ICIKIFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |