Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G34710_circ_g.11 |
| ID in PlantcircBase | ath_circ_016498 |
| Alias | AT2G34710_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14642165-14642362 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, CIRI-full, CIRI2 |
| Parent gene | AT2G34710 |
| Parent gene annotation |
Homeobox-leucine zipper protein ATHB-14 |
| Parent gene strand | - |
| Alternative splicing | AT2G34710_circ_g.4 AT2G34710_circ_g.5 AT2G34710_circ_g.6 AT2G34710_circ_g.7 AT2G34710_circ_g.8 AT2G34710_circ_g.9 AT2G34710_circ_g.10 AT2G34710_circ_g.12 AT2G34710_circ_g.13 |
| Support reads | 4 |
| Tissues | whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G34710.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.518515276 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14642249-14642167(-) |
| Potential amino acid sequence |
MYAPTTLAAARDFWTLRYSTCLEDGSYVVAEILKDRPSWLRDCRSVDTLSVIPAGNGGTIELIY TQMYAPTTLAAARDFWTLRYSTCLEDGSYVVAEILKDRPSWLRDCRSVDTLSVIPAGNGGTIEL IYTQMYAPTTLAAARDFWTLRYSTCLEDGSYVVAEILKDRPSWLRDCRSVDTLSVIPAGNGGTI ELIYTQMYAPTTLAAARDFWTLRYSTCLEDGSYV(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |