Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0661766_circ_g.1 |
ID in PlantcircBase | osa_circ_031854 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 27273421-27273716 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0661766 |
Parent gene annotation |
Hypothetical conserved gene. (Os06t0661766-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0661766-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016517 |
PMCS | 0.100225225 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27273462-27273448(+) 27273477-27273621(-) |
Potential amino acid sequence |
MGMEHLLNTASPSSGFIEEMRELEKLRTETMMKSCQSTTSRAGAIRCPVPRKSGRDFADLKSYS *(+) MFHAHDSQSGIRFKISKVPATLAWYWTSYRSSPACSALAGFHHCFCSQLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |