Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0173500_circ_g.1 |
| ID in PlantcircBase | osa_circ_018147 |
| Alias | Os_ciR4766 |
| Organism | Oryza sativa |
| Position | chr3: 3932939-3933186 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0173500 |
| Parent gene annotation |
Similar to Kinase associated protein phosphatase. (Os03t0173500- 01);Similar to Kinase associated protein phosphatase. (Os03t0173 500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/2 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0173500-02:1 Os03t0173500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.253566398 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3933106-3932962(-) 3932955-3933015(-) |
| Potential amino acid sequence |
MVFNFIFHSSHCSYIEKQASTKFTRSAHQTNKCTTIEELSPKKKHVVLTSDGTEEDRRQSKNSN TCERPEKVFGVHRFTDQRPWFSILFFTHRIAPTSKNKPAQSLQGLHIKLTNVPQSKNYLLRKSM SF*(-) MARKKIEDRAKTLIHVNGRKKFLECTGSQIRGHGFQFYFSLIALLLHRKTSQHKVYKVCTSN*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |