Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d046590_circ_g.3 |
ID in PlantcircBase | zma_circ_009995 |
Alias | zma_circ_0003269, GRMZM2G087806_C1 |
Organism | Zea mays |
Position | chr9: 97456980-97457291 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d046590 |
Parent gene annotation |
Protein S-acyltransferase 24 |
Parent gene strand | - |
Alternative splicing | Zm00001d046590_circ_g.1 Zm00001d046590_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d046590_T003:2 Zm00001d046590_T007:2 Zm00001d046590_T006:2 Zm00001d046590_T009:2 Zm00001d046590_T008:2 Zm00001d046590_T001:2 Zm00001d046590_T002:2 Zm00001d046590_T005:2 Zm00001d046590_T004:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.286722429 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
97456999-97456998(+) 97457188-97457224(-) |
Potential amino acid sequence |
MTKPAVARKTPDHANIPNGAVVVMAYCPDITECVYVISMPIMVHQRRGASPNFDNFPNLVFAPH PLPCTLLALSCYIYRT*(+) MLITYTHSVISGQYAMTTTAPFGIFAWSGVFLATAGLVMFYKCSRTMLEGYTAKDVVRTPDLGN CQN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |