Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G55840_circ_g.7 |
| ID in PlantcircBase | ath_circ_007625 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 20875462-20875644 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G55840 |
| Parent gene annotation |
At1g55840/F14J16_2 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 12 |
| Tissues | aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G55840.2:1 AT1G55840.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.258199137 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20875465-20875641(+) |
| Potential amino acid sequence |
MTAITTIDDLNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLKLMTA ITTIDDLNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLKLMTAITT IDDLNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLKLMTAITTIDD LNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |