Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G55840_circ_g.7 |
ID in PlantcircBase | ath_circ_007625 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 20875462-20875644 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G55840 |
Parent gene annotation |
At1g55840/F14J16_2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 12 |
Tissues | aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G55840.2:1 AT1G55840.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.258199137 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20875465-20875641(+) |
Potential amino acid sequence |
MTAITTIDDLNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLKLMTA ITTIDDLNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLKLMTAITT IDDLNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLKLMTAITTIDD LNYPEKTETYYVVNVPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |