Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0704200_circ_g.1 |
ID in PlantcircBase | osa_circ_021157 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 28309041-28309678 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0704200 |
Parent gene annotation |
Zinc finger, MYND-type domain containing protein. (Os03t0704200- 01) |
Parent gene strand | - |
Alternative splicing | Os03g0704200_circ_g.2 Os03g0704200_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0704200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013477 |
PMCS | 0.168597571 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28309045-28309573(-) 28309618-28309650(-) |
Potential amino acid sequence |
METKVIHARNVALLEMGKSYKRWLAMYYYYLTKSLP*(-) MASDVLLLSDKVSSLVSSGIDNSEVGSMYKTIEELERKLYHPLSITLLHTRETLLKIYMELQDW QTALMYCRLTIPVYERIYPPFHPMIGLQFYTCGKLEWKQRLYMPEM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |