Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0556700_circ_g.17 |
| ID in PlantcircBase | osa_circ_007977 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 21896377-21896522 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os10g0556700 |
| Parent gene annotation |
CCR4-Not1 complex component, mRNA deadenylation (Os10t0556700-01 ) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0556700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.32502403 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21896488-21896485(-) |
| Potential amino acid sequence |
MINNISTSNMEAKAREFNEVLQEQYYPWFAQYMVMKRPLLLKFKTRFSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |