Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G26910_circ_g.9 |
| ID in PlantcircBase | ath_circ_015079 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 11485186-11485308 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, CIRI-full |
| Parent gene | AT2G26910 |
| Parent gene annotation |
PEC1 |
| Parent gene strand | + |
| Alternative splicing | AT2G26910_circ_g.8 AT2G26910_circ_g.10 AT2G26910_circ_g.11 AT2G26910_circ_g.12 |
| Support reads | 7 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G26910.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.34752019 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11485189-11485188(-) |
| Potential amino acid sequence |
MHVLSLNAASTLLVPQQTHRLFFSFLSRLTLLWIQRLETYPMHVLSLNAASTLLVPQQTHRLFF SFLSRLTLLWIQRLETYPMHVLSLNAASTLLVPQQTHRLFFSFLSRLTLLWIQRLETYPM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |