Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G26910_circ_g.9 |
ID in PlantcircBase | ath_circ_015079 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 11485186-11485308 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, CIRI-full |
Parent gene | AT2G26910 |
Parent gene annotation |
PEC1 |
Parent gene strand | + |
Alternative splicing | AT2G26910_circ_g.8 AT2G26910_circ_g.10 AT2G26910_circ_g.11 AT2G26910_circ_g.12 |
Support reads | 7 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G26910.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.34752019 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11485189-11485188(-) |
Potential amino acid sequence |
MHVLSLNAASTLLVPQQTHRLFFSFLSRLTLLWIQRLETYPMHVLSLNAASTLLVPQQTHRLFF SFLSRLTLLWIQRLETYPMHVLSLNAASTLLVPQQTHRLFFSFLSRLTLLWIQRLETYPM(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |