Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d039219_circ_g.1 |
ID in PlantcircBase | zma_circ_009198 |
Alias | zma_circ_0002446 |
Organism | Zea mays |
Position | chr6: 173070154-173070504 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d039219 |
Parent gene annotation |
Putative pleckstrin-like proteiny (PH) domain-containing family protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d039219_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152492639 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
173070185-173070165(+) 173070489-173070205(+) 173070179-173070453(-) 173070237-173070481(-) |
Potential amino acid sequence |
MDDVYGRIEVFPQHFVPSKEAMETPDGLSTSKNSLDSPPSSCKRSWTPRRVKGAASILHLLSIP RIRWSTSNEDDDKSMRF*(+) MRMMTRVCASNTCIFGWMMYMDG*(+) MQVLEAHTLVIILIACRPSYAGNGQ*(-) MVQSVGGRPLSVHIHHPSKYASVRSAYSCHHPHCL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |