Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d039219_circ_g.1 |
| ID in PlantcircBase | zma_circ_009198 |
| Alias | zma_circ_0002446 |
| Organism | Zea mays |
| Position | chr6: 173070154-173070504 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d039219 |
| Parent gene annotation |
Putative pleckstrin-like proteiny (PH) domain-containing family protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d039219_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152492639 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
173070185-173070165(+) 173070489-173070205(+) 173070179-173070453(-) 173070237-173070481(-) |
| Potential amino acid sequence |
MDDVYGRIEVFPQHFVPSKEAMETPDGLSTSKNSLDSPPSSCKRSWTPRRVKGAASILHLLSIP RIRWSTSNEDDDKSMRF*(+) MRMMTRVCASNTCIFGWMMYMDG*(+) MQVLEAHTLVIILIACRPSYAGNGQ*(-) MVQSVGGRPLSVHIHHPSKYASVRSAYSCHHPHCL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |