Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G63190_circ_g.2 |
| ID in PlantcircBase | ath_circ_028908 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 23342978-23343530 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI-full |
| Parent gene | AT3G63190 |
| Parent gene annotation |
Ribosome-recycling factor, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | AT3G63190_circ_g.1 AT3G63190_circ_g.3 AT3G63190_circ_g.4 AT3G63190_circ_g.5 AT3G63190_circ_g.6 AT3G63190_circ_g.7 AT3G63190_circ_g.8 AT3G63190_circ_g.9 AT3G63190_circ_g.10 AT3G63190_circ_g.11 AT3G63190_circ_g.12 AT3G63190_circ_g.13 AT3G63190_circ_g.14 |
| Support reads | 1 |
| Tissues | seed, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G63190.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.167795946 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23343017-23342980(-) |
| Potential amino acid sequence |
MKKIEELYKQKEKELSKVVAKQSEEGKVALRNIRRDALKSYDKLEKEKKLSEDNVKDLSSDLQK LIDVYMKKIEELYKQKEKELSKVVAKQSEEGKVALRNIRRDALKSYDKLEKEKKLSEDNVKDLS SDLQKLIDVYMKKIEELYKQKEKELSKVVAKQSEEGKVALRNIRRDALKSYDKLEKEKKLSEDN VKDLSSDLQKLIDVYMKKIEELYKQKEK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |