Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G02830_circ_g.7 |
| ID in PlantcircBase | ath_circ_019384 |
| Alias | At_ciR4246, Ath_circ_FC1786, AT3G02830_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 614935-615174 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI2 |
| Parent gene | AT3G02830 |
| Parent gene annotation |
Zinc finger CCCH domain-containing protein 33 |
| Parent gene strand | + |
| Alternative splicing | AT3G02830_circ_g.3 AT3G02830_circ_g.4 AT3G02830_circ_g.5 AT3G02830_circ_g.6 |
| Support reads | 4/40/3 |
| Tissues | leaf/inflorescences, whole_plant/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G02830.2:1 AT3G02830.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.530195353 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
615028-615171(+) |
| Potential amino acid sequence |
MMVPTSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSNEVDCAYFLRTGHCK FGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPY SNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRWQDPSSYAS LIMPQGVVPVQGWNPYSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRA SFIASPRWQDPSSYASLIMPQGVVPVQGWNPYS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Pan et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |