Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G02830_circ_g.7 |
ID in PlantcircBase | ath_circ_019384 |
Alias | At_ciR4246, Ath_circ_FC1786, AT3G02830_C1 |
Organism | Arabidpsis thaliana |
Position | chr3: 614935-615174 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI2 |
Parent gene | AT3G02830 |
Parent gene annotation |
Zinc finger CCCH domain-containing protein 33 |
Parent gene strand | + |
Alternative splicing | AT3G02830_circ_g.3 AT3G02830_circ_g.4 AT3G02830_circ_g.5 AT3G02830_circ_g.6 |
Support reads | 4/40/3 |
Tissues | leaf/inflorescences, whole_plant/seedlings |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G02830.2:1 AT3G02830.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.530195353 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
615028-615171(+) |
Potential amino acid sequence |
MMVPTSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPYSNEVDCAYFLRTGHCK FGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRWQDPSSYASLIMPQGVVPVQGWNPY SNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIASPRWQDPSSYAS LIMPQGVVPVQGWNPYSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRA SFIASPRWQDPSSYASLIMPQGVVPVQGWNPYS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Pan et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |