Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g074650.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003142 |
Alias | 10:57524232|57525214, Slcirc155 |
Organism | Solanum lycopersicum |
Position | chr10: 58199700-58200682 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc10g074650.1 |
Parent gene annotation |
Hexosyltransferase |
Parent gene strand | - |
Alternative splicing | Solyc10g074650.1_circ_g.1 |
Support reads | 22/21 |
Tissues | fruit/leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc10g074650.1.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.94758167 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
58200662-58200679(-) |
Potential amino acid sequence |
MESVIAQAKACHVDCSNVDKKFRQLVDLTEDEATFHMRQSAFLYQLAVQTMPKSHHCLSMRLTV EYFRDPPPDIDQSLVERLLNPDLRHFVIFSSNVLASSAVINSTVTHAKESENQVFHVVTDKQNY FAMKLWFSRNKYMEATVEVLNIEDHKLENNKASTSIHLSLPEEYRVSFHKVDGPPTTEYLSVFS HSHYLLPEIFPSLKKVVVLDDDIIVQRDLSVLWGINMDGKVNGAVQCCSVRLIQLQKLFADKRL DETSCAWMSGLNVIDLVRWREQDISGTYLKLVTED*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018; Wang et al., 2018b |