Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0204900_circ_g.7 |
| ID in PlantcircBase | osa_circ_033158 |
| Alias | Os_ciR11288 |
| Organism | Oryza sativa |
| Position | chr7: 5649050-5649323 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0204900 |
| Parent gene annotation |
Similar to Zeta-carotene desaturase (Fragment). (Os07t0204900-01 );Similar to Zeta-carotene desaturase. (Os07t0204900-02);Similar to Zeta-carotene desaturase. (Os07t0204900-03) |
| Parent gene strand | + |
| Alternative splicing | Os07g0204900_circ_g.3 Os07g0204900_circ_g.4 Os07g0204900_circ_g.5 Os07g0204900_circ_g.6 Os07g0204900_circ_g.8 Os07g0204900_circ_g.9 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0204900-03:2 Os07t0204900-01:2 Os07t0204900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.296959945 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5649289-5649065(+) 5649238-5649295(-) |
| Potential amino acid sequence |
MGYRTSRFGEIKATSREIIKADAYVAACDVPGIKRLLPSEWRQWDTFDNIYKLDGVPVVTVQLR YNGWVTELQDLEKSRLQVER*(+) MLSNVSHCLHSEGKSLLIPGTSQAATYASALIISLLVALISPNLEVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |