Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0567100_circ_g.9 |
| ID in PlantcircBase | osa_circ_029004 |
| Alias | Os_ciR10130 |
| Organism | Oryza sativa |
| Position | chr5: 28235123-28236409 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0567100 |
| Parent gene annotation |
Aspartic proteinase oryzasin 1 precursor (EC 3.4.23.-). (Os05t05 67100-01);Aspartic proteinase oryzasin 1 precursor (EC 3.4.23.-) . (Os05t0567100-02);Similar to Phytepsin. (Os05t0567100-03) |
| Parent gene strand | + |
| Alternative splicing | Os05g0567100_circ_g.2 Os05g0567100_circ_g.3 Os05g0567100_circ_g.4 Os05g0567100_circ_g.5 Os05g0567100_circ_g.6 Os05g0567100_circ_g.7 Os05g0567100_circ_g.8 Os05g0567100_circ_g.10 Os05g0567100_circ_g.11 Os05g0567100_circ_g.12 Os05g0567100_circ_g.13 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0567100-03:4 Os05t0567100-01:4 Os05t0567100-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23438738 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28236318-28235149(+) 28235817-28236404(-) |
| Potential amino acid sequence |
MCNACEMAVVWMQNQLAQNKTQDLILNYINQDFVLAVVQL*(+) MAVGPASNDVPESAIAEQPLAQNPD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |