Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0498400_circ_g.8 |
| ID in PlantcircBase | osa_circ_030960 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 17497002-17497215 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0498400 |
| Parent gene annotation |
Similar to Alpha-glucan water dikinase, chloroplast precursor (E C 2.7.9.4) (Starch-related R1 protein). (Os06t0498400-01);Simila r to Alpha-glucan water dikinase (Fragment). (Os06t0498400-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0498400_circ_g.7 Os06g0498400_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0498400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.435141667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17497169-17497022(+) 17497053-17497022(+) |
| Potential amino acid sequence |
MPDVLSHVSVRARNCKLAGYKPS*(+) MNCLLFKTNPMINQLSLWQRVSRERKKYQMELLVLLHLICQMFSPMYQSEQGIASWQVISPVEV SGYIVVVDELLAVQNKSYDKPTILVAKSVKGEEEIPDGVVGVITPDMPDVLSHVSVRARNCKLA GYKPS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |