Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g018500.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003329 |
Alias | NA |
Organism | Solanum lycopersicum |
Position | chr11: 8624991-8625333 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc11g018500.1 |
Parent gene annotation |
Beta-galactosidase |
Parent gene strand | + |
Alternative splicing | Solyc11g018500.1_circ_g.1 Solyc11g018500.1_circ_g.3 |
Support reads | 2 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc11g018500.1.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.295280345 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8625272-8625330(+) |
Potential amino acid sequence |
MAYHVALFIARKNGTFINYYMINACNGLRCGETFTGPNSPNKPSIWTENWTSFYQVYGQNATLR SAEDMAYHVALFIARKNGTFINYYMINACNGLRCGETFTGPNSPNKPSIWTENWTSFYQVYGQN ATLRSAEDMAYHVALFIARKNGTFINYYMINACNGLRCGETFTGPNSPNKPSIWTENWTSFYQV YGQNATLRSAEDMAYHVALFIARKNGTFINYYM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zuo et al., 2016 |