Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0584600_circ_g.7 |
| ID in PlantcircBase | osa_circ_029118 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 29096977-29097288 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0584600 |
| Parent gene annotation |
Similar to ATP binding / nucleoside-triphosphatase/ nucleotide b inding. (Os05t0584600-01);ATPase, AAA-type, core domain containi ng protein. (Os05t0584600-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0584750-00:1 Os05t0584600-02:2 Os05t0584750-00:1 Os05t0584600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.278336432 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29097259-29097014(+) 29097251-29097239(-) |
| Potential amino acid sequence |
MWSQKWTGFEPGPHICTACLTLQ*(+) MSDLIGSFTIFPKSAEPRESLQRQTSSADVRSRLKASPFLRPHLGGCLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |