Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0268300_circ_g.4 |
| ID in PlantcircBase | osa_circ_001267 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 9231546-9232853 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0268300 |
| Parent gene annotation |
Similar to DNA gyrase B subunit. (Os01t0268300-01);Similar to DN A gyrase subunit B, chloroplastic/mitochondrial. (Os01t0268300-0 2) |
| Parent gene strand | + |
| Alternative splicing | Os01g0268300_circ_g.2 Os01g0268300_circ_g.3 Os01g0268300_circ_g.5 Os01g0268300_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0268300-02:5 Os01t0268300-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133907492 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9231946-9231551(+) |
| Potential amino acid sequence |
MTCIIAVKVPNPEFEGQTKTRLGNPEVRRIVEQSVQENLTEYLELHPDVLDSILSKSLNALKAA LAAKRARELVRTKSVLKSSSLPGKLADCASSDPEESEIFIVEGDSAGGSAKQGRDRKFQVL*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |