Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d041711_circ_g.2 |
| ID in PlantcircBase | zma_circ_007644 |
| Alias | Zm03circ00043, zma_circ_0001137, GRMZM2G116204_C1 |
| Organism | Zea mays |
| Position | chr3: 134551808-134552695 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d041711 |
| Parent gene annotation |
Auxin-binding protein 1 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d041711_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d041711_T002:3 Zm00001d041711_T004:3 Zm00001d041711_T005:3 Zm00001d041711_T003:3 Zm00001d041711_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.145103519 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
134551838-134551808(+) 134551831-134552431(-) 134551818-134552415(-) |
| Potential amino acid sequence |
MPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGS SSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKI*(+) MSLTNELYLSRRSRYDHKNLQIFVLVRIPNLVWIIYRD*(-) MSYILAGGLDMITRTCKSSCSSEFQTWCGSFTGIENVVF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |