Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d041711_circ_g.2 |
ID in PlantcircBase | zma_circ_007644 |
Alias | Zm03circ00043, zma_circ_0001137, GRMZM2G116204_C1 |
Organism | Zea mays |
Position | chr3: 134551808-134552695 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d041711 |
Parent gene annotation |
Auxin-binding protein 1 |
Parent gene strand | + |
Alternative splicing | Zm00001d041711_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d041711_T002:3 Zm00001d041711_T004:3 Zm00001d041711_T005:3 Zm00001d041711_T003:3 Zm00001d041711_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145103519 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
134551838-134551808(+) 134551831-134552431(-) 134551818-134552415(-) |
Potential amino acid sequence |
MPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGS SSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKI*(+) MSLTNELYLSRRSRYDHKNLQIFVLVRIPNLVWIIYRD*(-) MSYILAGGLDMITRTCKSSCSSEFQTWCGSFTGIENVVF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |