Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G083500_circ_g.2 |
| ID in PlantcircBase | gra_circ_000599 |
| Alias | Chr06:31637787|31638269 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 31637787-31638269 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G083500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.006G083400_circ_g.1 orai.006G083400_circ_ag.1 orai.006G083500_circ_g.1 |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G083500.3:2 Gorai.006G083500.4:2 Gorai.006G083500.1:2 Gorai.006G083500.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.799688751 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31638195-31638267(-) |
| Potential amino acid sequence |
MQPIEHVLRSPSPEDLVSVLQVVVTLAFGSDTVAHKMLSKDIMKSLEILFGHKNPEVQRLALLA VGNLAFCRENHNILVTSENLRELLMRLTATPERRVNKAAARALAILG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |