Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014033_circ_g.1 |
ID in PlantcircBase | zma_circ_008432 |
Alias | zma_circ_0002055, ZmciR232 |
Organism | Zea mays |
Position | chr5: 29815011-29820309 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d014033 |
Parent gene annotation |
Transportin MOS14 |
Parent gene strand | - |
Alternative splicing | Zm00001d014033_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d014033_T005:5 Zm00001d014033_T001:4 Zm00001d014033_T003:4 Zm00001d014033_T004:4 Zm00001d014033_T002:5 Zm00001d014033_T006:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.088750798 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29820239-29815025(+) 29815498-29820295(-) |
Potential amino acid sequence |
MSKILAVFLGKGVVVLRVFNSKTDLHICT*(+) MSLLPCLPQHEQLLQTVCLTIGAFSKWIDAAPAELSILPPLVDILNKGMSTSEDTAAAASMAFK YICEGQFSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |