Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d014033_circ_g.1 |
| ID in PlantcircBase | zma_circ_008432 |
| Alias | zma_circ_0002055, ZmciR232 |
| Organism | Zea mays |
| Position | chr5: 29815011-29820309 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d014033 |
| Parent gene annotation |
Transportin MOS14 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d014033_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d014033_T005:5 Zm00001d014033_T001:4 Zm00001d014033_T003:4 Zm00001d014033_T004:4 Zm00001d014033_T002:5 Zm00001d014033_T006:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.088750798 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29820239-29815025(+) 29815498-29820295(-) |
| Potential amino acid sequence |
MSKILAVFLGKGVVVLRVFNSKTDLHICT*(+) MSLLPCLPQHEQLLQTVCLTIGAFSKWIDAAPAELSILPPLVDILNKGMSTSEDTAAAASMAFK YICEGQFSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |