Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d019432_circ_g.7 |
ID in PlantcircBase | zma_circ_009254 |
Alias | zma_circ_0002707, GRMZM2G145063_C5 |
Organism | Zea mays |
Position | chr7: 33491476-33492145 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d019432 |
Parent gene annotation |
Zn-dependent exopeptidases superfamily protein |
Parent gene strand | - |
Alternative splicing | Zm00001d019432_circ_g.1 Zm00001d019432_circ_g.2 Zm00001d019432_circ_g.3 Zm00001d019432_circ_g.4 Zm00001d019432_circ_g.5 Zm00001d019432_circ_g.6 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d019432_T006:3 Zm00001d019432_T002:3 Zm00001d019432_T008:3 Zm00001d019432_T003:3 Zm00001d019432_T009:3 Zm00001d019432_T005:3 Zm00001d019432_T010:3 Zm00001d019432_T004:3 Zm00001d019432_T011:3 Zm00001d019432_T007:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.299985545 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33492036-33491481(+) 33492144-33492122(-) |
Potential amino acid sequence |
MIEITTENKNYIKSWNVCNVFSKYSIICITWNYSKHILS*(+) MFGIIPGDTDYRIFAEDITNIPGLDIIFVLGGYFYHTSYDTLENLLPGSIQARGENLFNLVKAF TNPMLLKENEISNKAAKDGIEDVGAVFFDYLTWFMVFYSRDISLILHSLPIAIFLLVPLFLKFP NITLMSWFVTLLGFMRGYVWNNSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |