Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0614700_circ_g.3 |
| ID in PlantcircBase | osa_circ_002612 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24377371-24378016 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0614700 |
| Parent gene annotation |
Similar to Adaptin ear-binding coat-associated protein 1. (Os01t 0614700-01);Adaptin ear-binding coat-associated protein 1 NECAP- 1 family protein. (Os01t0614700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0614750-00:2 Os01t0614700-02:2 Os01t0614750-00:2 Os01t0614700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.151207018 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24377458-24377400(+) 24377389-24377973(-) |
| Potential amino acid sequence |
MKYLNKKKTAEEMVQHYEKSSSVDYSLKEGETLVLQLKNMDVSAMPLLV*(+) MALTSIFFSCKTKVSPSLRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |