Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G15380_circ_g.1 |
ID in PlantcircBase | ath_circ_021910 |
Alias | AT3G15380_C1, AT3G15380_C1 |
Organism | Arabidpsis thaliana |
Position | chr3: 5194225-5194370 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT3G15380 |
Parent gene annotation |
Choline transporter protein 1 |
Parent gene strand | + |
Alternative splicing | AT3G15380_circ_g.2 AT3G15380_circ_g.3 AT3G15380_circ_g.4 AT3G15380_circ_g.5 AT3G15380_circ_g.6 AT3G15380_circ_g.7 AT3G15380_circ_g.8 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G15380.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.46379697 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5194288-5194314(+) |
Potential amino acid sequence |
MGGVNIQEDMIIDKSIRRSMNSRASVLKFIGAANILLVLQIHPYATGSRWVVLIFKRT* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |