Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0147400_circ_g.2 |
| ID in PlantcircBase | osa_circ_006214 |
| Alias | Os_ciR921, |
| Organism | Oryza sativa |
| Position | chr10: 2852155-2852620 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circseq_cup, find_circ, CIRI-long |
| Parent gene | Os10g0147400 |
| Parent gene annotation |
Similar to Auxin influx carrier protein. (Os10t0147400-01);Simil ar to Auxin transporter-like protein 3. (Os10t0147400-03) |
| Parent gene strand | - |
| Alternative splicing | Os10g0147400_circ_g.1 |
| Support reads | 22/36/37 |
| Tissues | root/root/shoot, root, pistil, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0147566-00:1 Os10t0147400-01:1 Os10t0147566-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
osi_circ_008779 hvu_circ_000018* osi_circ_015536 osi_circ_010944 zma_circ_007737* zma_circ_001454 |
| PMCS | 0.527873319 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2852615-2852615(-) |
| Potential amino acid sequence |
MHAMWRPQKFKAIYLLATVYVLTLTLPSASAAYWAFGDALLTHSNALALLPRTPWRDAAVVLML IHQFITFGFACTPLYFVWEKLVGLHGCPSLCKRAAARLPVVLPIWFLAIIFPFFGPINSAVGSL LVSFTVYIIPSLAYMVTFRSPQSRQGDNARDVAAAEVQGDLPAGDGVRADADAAVGVGGVLGVR GRAADALERAGAAAADAVARRRGGAHAHPPVHHLRLRLHPALLRLGEARRPPRLPLPLQARRRP PPRRPPHLVPRHHLPLLRPHQLRRRLPPRQLHRLHHPLPRLHGHLPLPAIPPGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017; this study |