Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0639800_circ_g.1 |
| ID in PlantcircBase | osa_circ_012520 |
| Alias | Os_ciR7511 |
| Organism | Oryza sativa |
| Position | chr12: 27440939-27441059 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os12g0639800 |
| Parent gene annotation |
Similar to CDS_VAMP. (Os12t0639800-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0639800-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.378817837 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27440959-27440980(+) 27440973-27440999(-) |
| Potential amino acid sequence |
MKYCMDHPEEVSKLAKVKAQVSEVKGIMMENIDKAKAWRADEVLHGSP*(+) MQYFICSPSLGLVNVFHHDAFNFRDLSFHFG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |