Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0469600_circ_g.10 |
ID in PlantcircBase | osa_circ_014644 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 15894250-15894493 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0469600 |
Parent gene annotation |
Similar to Cysteine proteinase 1 precursor (EC 3.4.22.-). (Os02t 0469600-01) |
Parent gene strand | + |
Alternative splicing | Os02g0469600_circ_g.1 Os02g0469600_circ_g.2 Os02g0469600_circ_g.3 Os02g0469600_circ_g.4 Os02g0469600_circ_g.5 Os02g0469600_circ_g.6 Os02g0469600_circ_g.7 Os02g0469600_circ_g.8 Os02g0469600_circ_g.9 |
Support reads | 68 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0469600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.364414344 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15894302-15894251(+) 15894378-15894251(+) 15894276-15894455(-) |
Potential amino acid sequence |
MTNAFSYLLKSGGLESEKDYPYTGRDGTCKFDKSKIVTSVQNFSVVSVDEDQIAANLVKHGPLA M*(+) MAPANLTSRRLLLQFRTSVLSLSMRIRLLPTLSNMGHLQCDSSEPDSCDAGCNGGLMTNAFSYL LKSGGLESEKDYPYTGRDGTCKFDKSKIVTSVQNFSVVSVDEDQIAANLVKHGPLAM*(+) MNQVLMNHIASGPCLTRLAAI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |