Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0469600_circ_g.10 |
| ID in PlantcircBase | osa_circ_014644 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 15894250-15894493 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0469600 |
| Parent gene annotation |
Similar to Cysteine proteinase 1 precursor (EC 3.4.22.-). (Os02t 0469600-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0469600_circ_g.1 Os02g0469600_circ_g.2 Os02g0469600_circ_g.3 Os02g0469600_circ_g.4 Os02g0469600_circ_g.5 Os02g0469600_circ_g.6 Os02g0469600_circ_g.7 Os02g0469600_circ_g.8 Os02g0469600_circ_g.9 |
| Support reads | 68 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0469600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.364414344 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15894302-15894251(+) 15894378-15894251(+) 15894276-15894455(-) |
| Potential amino acid sequence |
MTNAFSYLLKSGGLESEKDYPYTGRDGTCKFDKSKIVTSVQNFSVVSVDEDQIAANLVKHGPLA M*(+) MAPANLTSRRLLLQFRTSVLSLSMRIRLLPTLSNMGHLQCDSSEPDSCDAGCNGGLMTNAFSYL LKSGGLESEKDYPYTGRDGTCKFDKSKIVTSVQNFSVVSVDEDQIAANLVKHGPLAM*(+) MNQVLMNHIASGPCLTRLAAI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |