Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc09g065270.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002913 |
| Alias | 9:58937233|58937990 |
| Organism | Solanum lycopersicum |
| Position | chr9: 63339714-63340471 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc09g065270.2 |
| Parent gene annotation |
Ribosome-recycling factor, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc09g065270.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.184294459 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
63340386-63340239(+) |
| Potential amino acid sequence |
MEKTVETVRSNFNSIRTGRASPAMLDKIEINFLLLVMWYVGRRLRITRAYGLEQGDCSLLLNRL GEREVEL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |