Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0140500_circ_g.2 |
| ID in PlantcircBase | osa_circ_026512 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 2332625-2333203 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0140500 |
| Parent gene annotation |
RNA binding motif protein 8 family protein. (Os05t0140500-01);Co re subunit of exon junction complex (EJC), Multiple organ develo pment and reproduction (Os05t0140500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0140500-01:2 Os05t0140500-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257464709 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2333171-2332628(+) 2332630-2333135(-) |
| Potential amino acid sequence |
MALSSAGIFGRAIEGWIVLVTGVHEEAQEDDLHNIFRDFGQVKNLHLNLDRRTGFVKGYALIEY ETFEEAQAAIKALDGTELLTQIISVDWAFSNGPVKRRNIRKSH*(+) MALPNIPALDRAITKCPINTYDLC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |