Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA007816_circ_g.3 |
ID in PlantcircBase | osi_circ_003767 |
Alias | 2:7895343|7896150 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 7895343-7896150 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA007816 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA007816_circ_g.1 BGIOSGA007816_circ_g.2 BGIOSGA007816_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA007816-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_013932* osa_circ_013930 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7895928-7895588(+) |
Potential amino acid sequence |
MKIANNKVGLVIGKGGETIKSMQAKSGARIQGTDLLSHLYLLMAAHLSTPHMVDTRVQAKQLKS QMEGLVLSLESREKL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |