Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0147050_circ_g.3 |
| ID in PlantcircBase | osa_circ_008428 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 2135656-2136226 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0147050 |
| Parent gene annotation |
Hypothetical protein. (Os11t0147050-00) |
| Parent gene strand | + |
| Alternative splicing | Os11g0147050_circ_g.2 Os11g0147050_circ_g.4 Os11g0147050_circ_g.5 Os11g0147050_circ_g.6 Os11g0147050_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0147000-01:3 Os11t0147050-00:3 Os11t0147000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2858939 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2136176-2135681(+) 2136146-2136212(-) 2135684-2136160(-) |
| Potential amino acid sequence |
MKKSFFQPSRLLHSICNSQDGFGGPT*(+) MNGRNLSPMWDKLVFNKIKARLGGRVRLMSSGASPLSADVMEFLRVCFGCLVIEGYGMTETSCV IATMDCDDRLIGHVGPPNPSCELQML*(-) MLDLQIHLVNYKCCEGVWRVERKIFSCCIQC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |