Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0580300_circ_g.3 |
ID in PlantcircBase | osa_circ_008209 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 23152532-23152851 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0580300 |
Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os10 t0580300-01) |
Parent gene strand | - |
Alternative splicing | Os10g0580300_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0580300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.225274583 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23152535-23152540(+) 23152787-23152595(-) |
Potential amino acid sequence |
MEIVETIEQLPEQRFDCVGIYGEVKLLSVMPDNLIEIVLGVIEGEVEGHVGVVDVNIDELDNIL VVDLTQKLWR*(+) MSLYLAFDYAEHDLYEIIRHHREKLNLPINPYTVKSLLWQLLNGLNYLHSFCVRSTTRMLSSSS MFTSTTPTCPSTSPSITPSTISMRLSGITERSLTSP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |