Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G46970_circ_g.24 |
| ID in PlantcircBase | ath_circ_026353 |
| Alias | AT3G46970_C1, AT3G46970_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 17305908-17306122 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT3G46970 |
| Parent gene annotation |
Alpha-glucan phosphorylase 2, cytosolic |
| Parent gene strand | - |
| Alternative splicing | AT3G46970_circ_g.16 AT3G46970_circ_g.17 AT3G46970_circ_g.18 AT3G46970_circ_g.19 AT3G46970_circ_g.20 AT3G46970_circ_g.21 AT3G46970_circ_g.22 AT3G46970_circ_g.23 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G46970.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.513092472 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17306113-17305972(-) |
| Potential amino acid sequence |
MANANGKAATSLPEKISAKANPEADDATEIAGNIVYHAKYSPHFSPLKFGPEQALYATAESLRD RLIQGDKRWQTPMEKLRLVYRRKSRLRRIRRPMMLRRSLGISSTTPSTVHISLH* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |