Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0164800_circ_g.1 |
ID in PlantcircBase | osa_circ_010568 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 3300108-3300726 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0164800 |
Parent gene annotation |
Hypothetical conserved gene. (Os12t0164800-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0164800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.182113463 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3300650-3300113(+) 3300609-3300684(-) |
Potential amino acid sequence |
MAACRSCYRHHLFSKCPMHRPHQHQKLQ*(+) MVSFNIFNSEEEGPAASSVILKFELIYAPTLENGSDIQASSATSSAAVHEFRVPRRALLGSHSY CPVHFDAFHSVLVDLTLHIVYLKAGATKSSLKLLMLVRTMHWAFGK*(-) |
Sponge-miRNAs | osa-miR2931 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |