Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0198600_circ_g.5 |
| ID in PlantcircBase | osa_circ_013690 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 5526974-5527467 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0198600 |
| Parent gene annotation |
Similar to DNA-damage inducible protein DDI1-like. (Os02t0198600 -01);Similar to predicted protein. (Os02t0198600-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 41 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0198600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.155220901 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5527383-5526979(+) |
| Potential amino acid sequence |
MSSILVHSQYWMLPIWNFFLGLICCGNIRLLRLLDQRYRGVAIGVGQSEILGRIHVAPIKIGHV FYPCSFTVLDAPNMEFLFGLDMLRKHQVA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |